McDonnell Genome Institute

Washington University

CircRNA

chr1|24651408|24655129|+|SRRM1|ENST00000323848.13

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.996

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

AGVLPLLQKRR

Amino Acids from 5' Exons

TQIQISFPKTIFPCQEREKAQSFSISPSQNQEPESFPCSRKEGKNSRAPRTFSESKRTFSTRGYFY,RKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATST,ANPDLLPLEDDLPLSGERESAVILDLPVTEPRAGVLPLLQKRRKKLQSSQNLQKKNLQYKRLLLL

Amino Acids from 3' Exons

KKTFVSILVWELIILFISFTVTTKEASQEDIQPPSENSVISFSKSSKAKAQAITSCNSTTQNSAFPYTPAVKPYKKKSCFCVSRENFR,RRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGK,EDVRQHPCLGVAHHPLHLVHGHHQRSLPRGHPAPLGKLVGYLLQQVLQGEGTGHHLLQLHHPKLGIPLHPSSQTVQEKVVFLCLQGELQVK