McDonnell Genome Institute

Washington University

CircRNA

chr1|245646120|245688807|+|KIF26B|ENST00000366518.4

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

VLGAGLHER

Amino Acids from 5' Exons

CLEVAAACISLISAAVKLLAKIEKEAQGCVSRCLLWAMSSWLSSMAANTFHT,VWRSQPPASHSRQLCESSQKSRRRLRAVSLAVCSGQCHPGSRQWQQTHSIQ,SGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVILALVNGSKHIPY

Amino Acids from 3' Exons

YTSSSSGGESSCEEGRMRRPTQLRPFHTRATVDPDFPIAHLSSDPDYSSSSEQSCDTVIYIGPNGTALSDKELTDNEGPPDFVPIVPALQKTRGDSRPAEAGEAAAGKSERDCLKCNTFAELQERLDCIDGSEEPSSFPFEELPAQFGPEQASRGPRLSQAAGASPLSESDKEDNGSEGQLTNREGPELPASKMQRSHSPVPAAAPAHSPSPASPRSVPGSSSQHSASPLVQSPSLQSSRESLNSCGFVEGKPRPMGSPRLGIASLSKTSEYKPPSSPSQRCKVYTQKGVLPSPAPLPPSSKDSGVASRESLLQPEVRTPPVGMSPQVLKKSMSAGSEGFPETPVDDEQQAATPSESKKEILSTTMVTVQQPLELNGEDELVFTLVEELTISGVLDSGRPTSIISFNSDCSARALASGSRPVSIISSISEDLECYSSTAPVSEVSITQFLPLPKMSLDEKAQDAGSRRSSISSWLSEMSAGSEGEQSCHSFIAQTCFGHGEAMAEPVASEFVSSLQNTAVVCREKPKASPDNLLILSEMGDDSFNKAAPIKGCKISTVSKAMVTISNTANLSSCEGYIPMKTNITVYPCIAMSPRNIQEPEAPTATPKAGPTLAQSRESKENSAKKEMKFEDPWLKREEEVKKETAHPNEEGMMRCETATGPSNAETRAEQEQDGKPSPGDRLSSSSGEVSASPVTDNFRRVVDGCEMALPGLATQSPVHPNKSVKSSSLPRAFQKASRQEEPDSLSYYCAAETNGVGAASGTPPSKATLEGKVASPKHCVLARPKGTPPLPPVRKSSLDQKNRASPQHSASGSGTSSPLNQPAAFPAGLPDEPSGKTKDASSSSKLFSAKLEQLASRSNSLGRATVSHYECLSLERAESLSSVSSRLHAGKDGTMPRAGRSLGRSAGTSPPSSGASPKAGQSKISAVSRLLLASPRARGPSASTTKTLSFSTKSLPQAVGQGSSSPPGGKHTPWSTQSLSRNRSSGLASKLPLRAVSGRISELLQGGAGARGLQLRAGPEAEARGGALAEDEPAAAHLLPSPYSKITPPRRPHRCSSGHGSDNSSVLSGELPPAMGKTALFYHSGGSSGYESVMRDSEATGSASSAQDSTSENSSSVGGRCRSLKTPKKRSNP,THPARPAGRAPAKKAACAGPPSDPSTPGPRWTLTSPSLTCPATPTTPPAASSPATPSSTSGPTARPSLTRSSPTTRAPQTLSLSCQPCRRPGATAGPQRQERLQPASQKGTASATRLPSCRRGWTASTAARSPAAFLSKNCLLSLGQSRQAEAPGAKQRGQAHSLSLIRKIMGPKVSPTEKALNSQPPRCRGVTHLCPPRHPPTAPARPHPGASRAAVASTAPPHSCRAPASRAAGRASTPAASWKASPGPWAPPGWASPACPRPRSTSHPALLPRDAKSTPRRGSCRLPPHCLPRARIPAWRLGSPCCSPRCVRPRLEAPRFKNPCLLGAKGSRKLLSMMSSRQLLLQSPRRRSAPRWRCSSHWSTVRTSWCSRWWRSPSAGSWTAAAPPASSASTATALHGPWPRARGPSASSAASARTWSATPARPPSPRSASHSSCPSRRAWMRRPRTQGADALPSAPGARARAVRVSSRATVSPRRVLGTGRQWQNLWPRSLSAASRTPLWCAERSPRPAPTTCSSCLRWEMTLSTKQPPSKAAKYPQARPWSPSPTRPIAAARGTSPRPISQFTPALPAPGTSKSRRPPPPPPKQAPHPSPGRVRKTVQRKRNLRTRGNEKRKKKRRLIPMKKGGVRLPRAPRMLRPEQSRSRTESPVRETGSAAAAERCRPPRSLTTSGGSWMGVRWPCPVWPPRAPCIPTKASSPAAFPGPFRRPAGRRSRTASPITALLRPTGWVQPRAPRPPRLPWRGRWLPPSTVFWLGPKGLPLCPLSESPAWTRRTGPALSTVPAAAAPAAPTNQPPSRRASQTSLAARRRTPAAAASSSVPSWSSWPAEATRWAGRQSATTNASPWSGPRACPPAPGCTRARTAPCPARGGAWAAAPGPRPPAPGPRPRPASPRSPPADSSWPAPERAARPPPPPKPSASPPSPCRRRWARAPARPPVGSTRPGPRSPSAGTGARAWPPSFPCGPSAGASRSCCRVARAPGACSCGPGPRRRRAGGPWPRTSPRPRTCSRRPTARSRPRGGPTAAAAATAATTAACAGSSRRPWGRRPCSTTAAAAAATRACGTARPPAARPRRRTPRARTAAPWAAGAGASRPRRNAPIQ,HIQLVRRGELLRRRPHAQAHPAETLPHQGHGGPLPHRSPVQRPRLLLQQRAVLRHRHLHRAQRHGPLQGAHRQRGPPRLCPYRASPAEDPGRQPARRGRRGCSRQVRKGLPEVQHVCRAAGEAGLHRRQRGAQQLSFRRTACSVWARAGKQRPPVKPSSGGKPTLVGRWVRRSADQQRRPTPSLQDAEESLTCARRGTRPQPQPGLTQERPGQQPAQRLPTRAEPQPPEQPGEPQLLRLRGRQAQAHGLPPAGHRQPVQDLGVQATQLSFPEMQSLHPEGGPAVSRPTASLEQGFRRGVGVLAAARGAYAPGWNEPPGFEKIHVCWERRVPGNSCRAAGSYSFRVQEGDPEHHDGDGAAATGAERGRAGVHAGGGADHQRGPGQRPPHQHHQLQQRLLCTGPGLGLAARQHHQQHQRGPGVLLQHGPRLRGQHHTVLAPPEDEPGEGPGRREQTLFHQLLAERDERGQGAVVPQFHSPDVFWARGGNGRTCGLGVCQQPPEHRCGVQREAQGQPRQLAHPVDGRLFQQSSPHQRLQNIHSEQGHGHHLQHGQSEQLRGVHPHEDQYHSLPLHCHEPPEHPRAGGPHRHPQSRPHISPVPGEGKQCKERDEIGPVAETRRGSEKRDGSSQRRDDEVDCHGPLECDQSRAGAGRKAQSGRQAQQQQRRGVGLPGHQLQEGRGWVDGPARFGHPEPRASQQKRQVQQPSQGLSEGQPAGGAGQPLLLLRCDQRGGCSLGHPALQGYPGGEGGFPQALCSGSAQRDSPSAPCPKVQPGPEEPGQPSAQCQRQRHQQPPEPTSRLPGGPPRRARQDEGRQQQQQALQCQAGAAGQQKQLAGQGDSQPLRMPLPGAGREPVLRELPAARGQGRHHAPRGEEPGPQRRDLAPQLRGLAQGRPVQDLRREQTPPGQPQSARPVRLHHQNPQLLHQVPAAGGGPGLQLAPRWEAHALVHAVPQQEQELGPGLQASPAGRQRAHLGAAAGWRGRPGLAAAGRARGGGARGGPGRGRARGRAPAPVALQQDHAPAEAPPLQQRPRQRQQQRAERGAPAGHGEDGPVLPQRRQQRLRERDAGQRGHRQRVLGAGLHEREQQLRGRQVPEPQDPEETLQS