McDonnell Genome Institute

Washington University

CircRNA

chr1|244552321|244572772|+|C1orf101|ENST00000366531.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9109

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

TLDLAYCSTNDK

Amino Acids from 5' Exons

DLAYCSTNDKRCTKGDRKPSYFSGLLYCRFSYSVDFSFVDHTNSWLFTNLLTTWSINGFLGCLCSCICCFGDRYGDLSHNFIQILDQNQSASRHSEKTECGSCDLIAGWNRFSYKWCSLHKEFSWIYKTGRNCKSSWWNYWHFIKKMVLGQLFIK,TWRIVVPMTKDDALKEIRGNQVTFQDCFIADFLILLTFPLLTIPEIPGYLPISSPRGSQLMASWDACVVASAVLVTDMETFHTTDSFKSWTRIRVPPDILSDDERRSVAHVILSRDGIVFLINGVLYIKSFRGFIRLGGIVNLPDGGITGISSRKWCWVNYLLK,PGVLYQQKMMHRRLEETKLLFRIALLQIFLFCLFLCPYLKFLVIYQSPHHVVVNWLPGMLVLHLLFWQIWRPFTQLIHSNLGPESECLQTFVMMKDGVWLMSYRGMESFFLMVFFTRVFVDLDWEELIFLMVELLAFHQENGVGSIIY

Amino Acids from 3' Exons

IIMEIFWKWKIMYFIPRLILEMQSCIYGQITQQEHSFSVHLVKHISCMLWMMAQYKYRTIPYIWKHKVLSQQKTNAHTWHFITMLLMFFTFWTRERLQFGLRSSIQKTLVCMLLWNLMAQKYYKRVMRFPLKLPLDTAPKL,LLWRYFGKNGKCNILFQDYRCSKAAFMDKLHNKSIHFLKYIWSNIFPVCFGWHNTNTGLSLTSGSTKYSFHNKRQMPIHGISQCCSCFLLFGQGRGSDSLDSDRLSRKHWSVCYCGILWPKNITRESDFLSCLWILHQNS,YYGDILVKMENNVIFYSKINTRDAVKLHLWTNYTTRAFIFLSTSGQTYFLYALDDGTIQIQDYPLHLEAQSIAFTTKDKCPYMAFHNNVAHVFYFLDKGEALTVWTQIVYPENTGLYVIVESYGPKILQESHEISFEAAFGYCTKTL