McDonnell Genome Institute

Washington University

CircRNA

chr1|244418759|244420296|-|ADSS|ENST00000366535.3

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

26

Peptide

VGIGAFPTEQDNGYMEKIKPMVRDGVYFLYEALHGPPK

Amino Acids from 5' Exons

GLTLLPLQIVLLEVFVLVWVCHLKMLEKCMELKLIQLELVLVPFLQSKT,DLPFCNLFKLYCWRCLYWFGYATSKCWRSVWSCESLYNSWYWCLSYRARQ,TYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDN

Amino Acids from 3' Exons

GYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDF,VIWKRLNQWEMEFIFYMRPYMDHQRKSWKVQMQHYILIL,LYGKDTNGERWSLFSIGPTWTTKENLGRRCKCSTIRYF