McDonnell Genome Institute

Washington University

CircRNA

chr1|243341038|243344331|+|SDCCAG8|ENST00000366541.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9555

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

DQMLILSQNIAQLEAQVEK

Amino Acids from 5' Exons

MLILSQNIAQLEAQVEKVTKEKISAINQLEEIQSQLASREMDVTK,CSCLRILPNWRPRWKRLQRKRFQLLINWRKFKASWLLGKWMSQ,VDLVSEYCPTGGPGGKGYKGKDFSYSTGGNSKPAGFSGNGCHK

Amino Acids from 3' Exons

VCGEMRYQLNKTNMEKDEAEKEHREFRAKTNRDLEIKDQ,CVEKCAISIKPTWRRMRQKRSTESSEQKLTGILKLKI,VWRNALSAENQHGEGGRKGAQRVQSKNQGSNRS