McDonnell Genome Institute

Washington University

CircRNA

chr1|243293090|243344331|+|SDCCAG8|ENST00000366541.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

21

7

Peptide

DLEIKDQGNMHNSWITTGEDSGVGETSK

Amino Acids from 5' Exons

GNMHNSWITTGEDSGVGETSKRPFSHDNADFGKAASAGEQLEL,ETCTILGLQQVKILGWAKPPKDHFPMTMQILAKLHLLVSSN,KHAQFLDYNRRFWGGRNLQKTIFPQCRFWQSCICWAART

Amino Acids from 3' Exons

VCGEMRYQLNKTNMEKDEAEKEHREFRAKTNRDLEIKDQ,CVEKCAISIKPTWRRMRQKRSTESSEQKLTGILKLKI,VWRNALSAENQHGEGGRKGAQRVQSKNQGSNRS