McDonnell Genome Institute

Washington University

CircRNA

chr1|243286271|243293219|+|SDCCAG8|ENST00000366541.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9843

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

10

Peptide

AASAGEQLELEELSGMK

Amino Acids from 5' Exons

EELSGMKNKIQVVVLENEGLQQQLKSQRQEETLREQTLLDAS,RNSLEKIKYKLCLKTKGSSNSNLKDKRRHGNKHFWMH,GTLWNEKNTSSCAKRRAPATAKISKTRGDTEGTNTSGCI

Amino Acids from 3' Exons

GNMHNSWITTGEDSGVGETSKRPFSHDNADFGKAASAGEQLEL,ETCTILGLQQVKILGWAKPPKDHFPMTMQILAKLHLLVSSN,KHAQFLDYNRRFWGGRNLQKTIFPQCRFWQSCICWAART