McDonnell Genome Institute

Washington University

CircRNA

chr1|243185778|243225321|-|CEP170|ENST00000366542.5

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9908

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

DDVALPK

Amino Acids from 5' Exons

TSSAHHRGGHGVPHGKLLKQKSEEPSVSIPFLQTALLRSSGSLGHRPSQEMDKMLKNQATSATSEKDNDDDQSDKGTYTIELENPNSEEVEARKMIDK,LALRITEGGMVFHMGNCNRNQRSHRCQYPSYKLHYEVQGVLGTDQARRWIKCKIKQLLLLLKRIMMMTKVTRVLIPLSRIPTVRKWKQEKLT,LCASQRGAWCSTWEIVKTEIRGAIGVNTLPTNCIIKKFRESWAQTKPGDGNVKKSSNFCYFKGPKQGYLYHVRESQQGSGSKKNDQ

Amino Acids from 3' Exons

DDVALPKTKLSRKAHPGFWAVEALATGCHEKFLLEEMTVSSCC,MTLCQRLRSAENELNILVFGEQWRHSPQAATRNDFCWKRLAHVA,RSFAKDLEAKQKMSLTSWFLVSSGGTRHRLPREMIFVGRDDCELMLQ