McDonnell Genome Institute

Washington University

CircRNA

chr1|243156220|243186422|-|CEP170|ENST00000336415.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

MIAFFDEDNPR

Amino Acids from 5' Exons

IQDGGAFLLIMLPPQKMNLDQTVIPLNIPVYVLLQPKPLACRALDQQCLLVLHSNTGLKSRKTTSEIGLLIEKRP,KFKMEALSYLCFHLRRIWIKPFPTYPSTYFSSPENHSLAERWISNAYFFIQTPDRAGRLHPRLDCSSRRDSQ,NSRWRRFPTDYASTSEDEFGSNRNSPKHTRLRTSPALKTTRLQSAGSAMPTSSSFKHRIKEQEDYIRDWTAHREEIA

Amino Acids from 3' Exons

EINMMMVRKVIQRTLGLTGAVANVQLLRNTDATIQNTKSYRRSRLLKSIKTKLLVKLLLLHSLMKTIPEKEGRILLLKVRESCVRKLHIQHHIQNLRKQSLQQQMPKWFLCLYRLALRITEGGMVFHMGNCNRNQRSHRCQYPSYKLHYEVQGVLGTDQARRWIKCKIKQLLLLLKRIMMMTKVTRVLIPLSRIPTVRKWKQEKLT,KTWYAKFRERWGSQALQTCNSGTLKTPPFRTQKATEGPGYKASRPSCCKSNCFYDCILRQSQKKKVVFFYSKCGNLVSGNYIFNTTYKTESKVSNSRCQSGFFVFTDLCASQRGAWCSTWEIVKTEIRGAIGVNTLPTNCIIKKFRESWAQTKPGDGNVKKSSNFCYFKGPKQGYLYHVRESQQGSGSKKNDQ,NKHDDGTQSDSENAGAHRRCSKRATLEEHLRRHHSEHKKLQKVQATEKHQDQAVVSQTAFMIAFFDEDNPRKRRSYSFTQSAGILCQETTYSTPHTKLEKAKSPTADAKVVSLSLQTSSAHHRGGHGVPHGKLLKQKSEEPSVSIPFLQTALLRSSGSLGHRPSQEMDKMLKNQATSATSEKDNDDDQSDKGTYTIELENPNSEEVEARKMIDK