McDonnell Genome Institute

Washington University

CircRNA

chr1|240123178|240294883|+|FMN2|ENST00000319653.13

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9663

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

17

Peptide

LDNSVVDLETLQALYENGER

Amino Acids from 5' Exons

GERCWRSCSASRRTGLQKKQRSFAPGSLPWVFSFLLVIASGNRVIRMPRRMQLRL,ANAVGEAVQPAGERASRRSREVLLPDHCHGSSPSFLLQGTVSECPDECSFV,RTLLEKLFSQQENGPPEEAEKFCSRIIAMGLLLPFSDCFREPCNQNAQTNAASFD

Amino Acids from 3' Exons

LLTWIILWLTWRPFKLSMR,CCELGFCGPGDPSSSLE,VVNLDNSVVDLETLQALYEN