McDonnell Genome Institute

Washington University

CircRNA

chr1|240123178|240178068|+|FMN2|ENST00000319653.13

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9247

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

6

Peptide

LEDAETGRTLLEK

Amino Acids from 5' Exons

GERCWRSCSASRRTGLQKKQRSFAPGSLPWVFSFLLVIASGNRVIRMPRRMQLRL,ANAVGEAVQPAGERASRRSREVLLPDHCHGSSPSFLLQGTVSECPDECSFV,RTLLEKLFSQQENGPPEEAEKFCSRIIAMGLLLPFSDCFREPCNQNAQTNAASFD

Amino Acids from 3' Exons

QDQLYTWAAVSQPTHSLDYSEGQFPRRVPSMGPPSKPPDEEHRLEDAET,KINFIPGLQLVNPHTHWTIQKGSFLGEFHPWGHHPNLPMRNTGSRMLKQ,RSTLYLGCSSTHTLIGLFRRAVSASSIHGATIQTSRGTQARGCN