McDonnell Genome Institute

Washington University

CircRNA

chr1|237772011|237784972|+|RYR2|ENST00000366574.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9053

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

SSSNASTNLR

Amino Acids from 5' Exons

IFRIIELRLAIIQLSTLSPLTTYEF,FSELSENSDWQYNCQHNYLHCRLPTESS,FQNYLRTQTGNNTTVNIIISTVDYLLRVQ

Amino Acids from 3' Exons

VMLLMERLANRWWICLWNLPTTWRFSNFLTCSNRIRRLILLKNMTPMARESFPRGTSTKRWRAISTTRSQKRNFFCLVRRRMRMKPSTTKSSSNASTNLRRTSASTSPSFQTSLSTCPTIPDFRLFWNQRASIISSPFWAASKSWEAPNASRGSILKSVSPAEPSGRSPRSRSPKDSSYLTWSTKAERKRRWNSLTSARTPSLKCSWRLRSRSRTTRGQRIRKKARRRGRKSRGRGWLSSPFRSGRPCLRSGTISPLCECSVRARSRKKKRPRTWSRPSFHPTGVFSPSCTSWPAFSEAFSASFAACCLGEASSKVLKRSKLQNCPTCQTPLRMRLEEMGRRERGNPWKPPCPPRIPTRSQRKVTFFRTSLAWIREKEDSTNFLIIQMLGSVTSATQSPCLRCRKNF,CCWNDWQTDGGYACGIFQQRGDDSQIFHVLKTKGFDVVYFRIPRWQGSHFQEGLPQSDGEPALHAVRNGISFVLCGDGENPRLRRVRQTLPRTCEGHRLQRRRPSDKPLAHAQRYPTSDFSGISRERPELFPALSGPHRNHGKRQTHREGLFNQVQPNPVGEAPGQGVQKTVHIRGQRRRREREDGTLCELLRGHHLNAAGGSDLGVGLEREVSEGRKREGEAGRAGAEDGFLLHSDGQVGPVCAQVQYLDPYANAQSEEPEEADEKSKKDDREGHGHGLLFILLEYFHDPLALRGQRFQRLFPHHLQPAAWGKPRRRCKDQSCRTVSQHARPHSGGRRWGGGREETPGSRPALRGSDRLKGADRGKPSFGHLWPGSEERRRTVQTDSSSKCWAQPHEQPSPHAGAGKIS,NVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVRSALFALRYNILTLMRMLSLKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVASVFRGFFRIICSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQ