McDonnell Genome Institute

Washington University

CircRNA

chr1|23754099|23756385|+|TCEB3|ENST00000418390.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9805

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

4

Peptide

STFSSPQEEEEAGFTGR

Amino Acids from 5' Exons

RSLHPRKKKKLDLLGAEIPRCRCILVPSVPISLKPCTSNASEYLKTTSI,VLFTPGRRRSWIYWAQNEFQDAGVFWFQVCLSPNDDLAPAMHPSTKQHR,FSSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNID

Amino Acids from 3' Exons

ADKQRWPLSTLWPSHLVTSGGGRKSLEREEQLSLRKS,PTSKDGLCQLCGQATSRPEEAGKVWNGRSSCPENQ,RQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKI