McDonnell Genome Institute

Washington University

CircRNA

chr1|236825337|236838599|+|MTR|ENST00000366577.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9643

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

15

Peptide

YGAAMVVMAFDEEGQVFPTPLVTMMK

Amino Acids from 5' Exons

VFPTPLVTMMKRLLWPST,SSQHLWLNAFYDGQAPK,LPNTFGDYDETPSMMAKHLK

Amino Acids from 3' Exons

VPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKKYGAAMVVMAFDEEGQ,YLCASTPPILLLKLGSAAKGSALSIALVRKERTTSWRRPGRLKSMELLWWSWLLMKKD,TFVHRLLQFCCDSWVKVLPREVHCQHSEGRRGRLLGEGQEDKVWSCYGGHGFRRT