McDonnell Genome Institute

Washington University

CircRNA

chr1|236803427|236829268|+|MTR|ENST00000366577.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.963

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

MLLSEGLK

Amino Acids from 5' Exons

KVRKPCGMRSMPFCRRGLWCWMEGWGPSSGRSTKNTSEVRNLKIMPGRKATMTFVLSLMSFTKSI,RSEENPAGDQCHSAEEDYGAGWRDGDHDPAGEAKRRTLPRSGIRSCQAAERQQHFKYNSACHLPNP,GLKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDILSITQPDVIYQIHK

Amino Acids from 3' Exons

GNCSCEKLASSTCHCFRTYVTV,EIAEAVKNCKPRVPPATAFEGHMLLS,KLLKLKIVSLEFHLPLLLKDICYCL