McDonnell Genome Institute

Washington University

CircRNA

chr1|236571350|236572554|-|HEATR1|ENST00000366581.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9839

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

2

Peptide

LSEMPQTHHHALLLLGTVAGIFPK

Amino Acids from 5' Exons

IFMRRSSTWSFSASAFRRCRRPITMPFYFWALLLEYF,YFRGEVQRGVDSSVHPPFGDAADPSPCPFTFGHCCWNIS,ILDEEKFNVELIVQCIRLSEMPQTHHHALLLLGTVAGIFP

Amino Acids from 3' Exons

KITRSRICSGSWRFLLAKSNSHPGITAAQKEAQKSSDIGANSFLAIK,KSQDLESVQEVGGSYWQRVTLILELLQHKKKLRSPQILVPTLFNLLS,NHKINLFRKLEVLTGKELSSWNYCSTKRSSEVLRYWCQLFLTCYQ