McDonnell Genome Institute

Washington University

CircRNA

chr1|235993644|236017273|-|NID1|ENST00000264187.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9835

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

25

Peptide

TRPGMTPPYIDECSEQPSVCGSHTICNNHPGTFR

Amino Acids from 5' Exons

RWRKPGASTSENTFSGQRGRQTHSDPFLRGCSFLSAMRTGTTRPPSATAAPATAGAWIATAARWRAPGPGPGRPR,GGENPVPARARTHSRGSGGDRPTATHSSGAVRSVRCARALRAHPVPRQHRLLLVRGSRRPRGGGHQDQARDDAP,VEKTRCQHEREHILGAAGATDPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVDRDGREVEGTRTRPGMTPP

Amino Acids from 3' Exons

ILMNVQNNPQCVGATQSAIITQEPSAASVWRATSFQMRERVW,YMFRTTLSVWEPHNLQSPRNLPLRVCGGLPVFRGNVC,IDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGTCV