McDonnell Genome Institute

Washington University

CircRNA

chr1|235990885|236048989|-|NID1|ENST00000264187.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9823

950

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

15

Peptide

AFLHVPVTTNGIIATSEPPAK

Amino Acids from 5' Exons

VVQWLPRFTKDLRCLPPSPCLLGPIYSLPRLGRLSACPWREIPGRQKQRRSFMS,SEYSGSPDSPRTCGAYRRDPLASWDPFTLCPDWEDAPAPGGKYHEEDRSKGVPSCP,LSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLEGNTMRKTEAKAFLHVP,VVQWLPRFTKDLRCLPPSPCLLGPIYSLPRLGRLSACPWREIPGRQKQRRSFMS,SEYSGSPDSPRTCGAYRRDPLASWDPFTLCPDWEDAPAPGGKYHEEDRSKGVPSCP,LSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLEGNTMRKTEAKAFLHVP

Amino Acids from 3' Exons

VTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKVYYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGK,SPQMASLLRVNPRPKNPIPGSSHQHSVQSPLSWRTWTRPMAWGRFIIEKTYPPPSLSEQQSVSTEGSRRSLSSLVARWLSLGNPWPPTKGPAGTQTRKA,HHKWHHCYETPGQRIPSRALPTNIRCSRPFPGGLGHDRWPGEGLLSRRLIPLHHSASSRVCPQRVPGDLFPARGGCHLGIRGPLPRAQQGPRPERQ,VTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKVYYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGK,SPQMASLLRVNPRPKNPIPGSSHQHSVQSPLSWRTWTRPMAWGRFIIEKTYPPPSLSEQQSVSTEGSRRSLSSLVARWLSLGNPWPPTKGPAGTQTRKA,HHKWHHCYETPGQRIPSRALPTNIRCSRPFPGGLGHDRWPGEGLLSRRLIPLHHSASSRVCPQRVPGDLFPARGGCHLGIRGPLPRAQQGPRPERQ