McDonnell Genome Institute

Washington University

CircRNA

chr1|235455558|235458786|-|B3GALNT2|ENST00000366600.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9003

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

IWMGLIFGGEK

Amino Acids from 5' Exons

DCGNNELQFVAEDRLLHRPRSCIDCPKESGWAFLVGK,TVETTSFNLLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWG,LWKQRASICCRQMMTVTTSKLYLIGLSKRIWMGLIFGGE

Amino Acids from 3' Exons

KVMLSYTTFILALKDLLIIGISMRKMPYRRKAASMMILFLWMLSTLIVMFLQNYTSID,RCSLTQPSFSPSKTYSYKESPGRCLTEGGKQHLYCFCGCCRHLSCSCKIIELLM,GDALLHNLHSRPQRLIDHIRNLHEEDALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYR