McDonnell Genome Institute

Washington University

CircRNA

chr1|235181584|235196115|-|ARID4B|ENST00000264183.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9378

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

DTMNGLK

Amino Acids from 5' Exons

LLKVLLKTVSRKMREVLKTWIIMAKRNLRLIIPTTEMILFQRRNRTVHLCKKTKFMQIWYPNQCQNLQKDGKIKYYPKILIMKKMKSQKRERMSRRTQQINLQNHKNVVKEGIAIQKSVKLDHLAKRKRRPRTKNHFAWKTVATALQMKMKKKQKQRHQLRNTMVWRKKENLYGQLVSIQDFQKWQKKGLNFITLMKDFKTAGPKIEKMSGQVFRDSGLKKRKSFFQTLILRLQLPHRILPQRRGWQRSHCRLWLKRRVVHPVNKNHLQSMSIVNPLKKKQRSMTEKQNFQVVAVIQCIPLLLHLNRLHQSLQKAAGSSLLQYQNHWLQTKKRFEVSRVKLIAQLRWIVLLGSSKTSSLKGIARQQVLMPVAQAVVISQNQNILKK,FKFCRQAGRERCSRHGWQRGIDSFDQQQKSYFKGGTEQFIFARRKQSSCRFGNIQTSVKISRKIKERYRSIIRRYLRRSHKKEKGCQEGHNRIFKTTNKTWKKVLQYRRVSKNWITWQKGREGQEQRITLHGKQQQLFRRRRNKSKDDTNEIQWFGGKKKISTDNWFLFRIFRSGRKKDTFKLKTSKQQGQRSKRCLVKYSGTVAKNAERAFFRLYGCSFPTASCPRGGGGRGVTADCGRGELFTQCRTRKTTSSQCRTHRKNSRGQQKSRISKWQFSAKYPSYYTIAFISHCNRRQPAAVFCNSIRTTGSKPRRGSKYQENHNGGCCWGAPRPPVRELASRFCQCELKQSARTRTSK,SESSAEDSEQEDERGAQDMDNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKRRYCNTEECLKTGSPGKKEEKAKNKESLCMENSSNSSSDEDEEETKAKMTPTKKYNGLEEKRKSLRTTGFYSGFSEVAEKRIKLLNNSDERLQNSRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPPHPAPEEGVAEESLQTVAEEESCSPSVELEKPPPVNVDSKPIEEKTVEVNDRKAEFPSSGSNSVLNTPPTTPESPSSVTVTEGSRQQSSVTVSEPLAPNQEEVRSIKSETDSTIEVDSVAGELQDLQSEGNSSPAGFDASVSSSSSNQPEPEHPEK

Amino Acids from 3' Exons

IRMDSRNSKTCKCAKDKTSEENK,YDEWIKADKIVRPADKNVPKIKHRKKIK,TMNGLKQIKDLLIKMCQRNIGRK