McDonnell Genome Institute

Washington University

CircRNA

chr1|232425588|232432471|-|SIPA1L2|ENST00000262861.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9381

39

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

14

Peptide

MVLTIQEALQLTVQK

Amino Acids from 5' Exons

FSFYGNLSPRRSLYRTLSDESICSNRRGSSFGSSRSSVLDQALPNDILFSTTPPYHSTLPPRAHPAPSMGSLR,FRSMGTCLQGGRFTARCLTRASAATGGGPPLAVPGVPCLTRPCPTTFCSAPPHPTTARCLRGPTPHPAWGAE,FVLWEPVSKEVALPHAVREHLQQQEGVLLWQFPEFRAPGPAQRHSVQHHPTLPQHAASAGPPRTQHGEPE

Amino Acids from 3' Exons

WFSPFRKPFSSLFKKWVSGFIQSLHRVSQQRTTGSRVHVQALPQTRGSEQICHRLEEIGGQPTARGASDMSR,GSHHSGSPSAHCSKSSGSLDSSKVYIVSHSSGQQVPGSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECP,VLTIQEALQLTVQKVVGLWIHPKSTSCLTAADNRFPGPCPSPTTDKGQTNMSSAGRNRRAAHRPRSLKLNVP