McDonnell Genome Institute

Washington University

CircRNA

chr1|231537212|231542611|+|TSNAX|ENST00000366639.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9606

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

4

Peptide

AITTAFQQELDAR

Amino Acids from 5' Exons

HFSRNLMQGMTNMRDLNLVGILLKVKGQFFSSIGLQ,ISAGTCKAQIETCETSGYNCKKDNFSPPDYK,FQQELDARHDKYERLVKLSRDITVESKRTIFLLHRIT

Amino Acids from 3' Exons

CSYGRYIDIRNIGWCQTKDIPGSPRAIRGRYASVPSSHYY,APDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITT,LLIWKIYLNQKLNWMVSDKRYSRPKSYQGKICISSIEPLLQ