McDonnell Genome Institute

Washington University

CircRNA

chr1|230332843|230357321|-|PGBD5|ENST00000391860.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

EDPQVLPR

Amino Acids from 5' Exons

GFTAAACSARGRVTAPASHCPCPTQPHPRPGASTKSRRGTCPSAGTTKDTSASPTPTPRCSR,DLLLRLAPRAEELHRPPTVHADQPSHTPGPGPVPNQDEGEHVLDLLVQQRTLPLPDQRLLPGAA,IYCCGLLRARKSDCTGLPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQ

Amino Acids from 3' Exons

VPPERCPPAPVPWTSSSSLSQTTSSRTWWCRQTCMPRSSRSGLGATEPGWRRRRRRSWATSPPASPTASPSSASGAEASTATAASPSSARPASRRSSSTSTSWPSAPARPRTGSTRSSPSSTPCRTASTLPSGLPKP,SHPKDAPQRQCRGLLPALCPRQRPQEHGGADKHVCQEVPGAVWERRSLGGGDADGDEGVPGLHDLHQHLPLRVRPQHLERRLLQQPQPRPRHEPGPLREDPQVLPRRGLPLQPDHARALQGPALPRLPAEQLRLCLQAFPNP,PTRKMPPSASAVDFFQLFVPDNVLKNMVVQTNMYAKKFQERFGSDGAWVEVTLTEMKAFLGYMISTSISHCESVLSIWSGGFYSNRSLALVMSQARFEKILKYFHVVAFRSSQTTHGLYKVQPFLDSLQNSFDSAFRPSQTQ