McDonnell Genome Institute

Washington University

CircRNA

chr1|230203136|230236725|+|GALNT2|ENST00000366672.4

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9981

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

KLMLEGR

Amino Acids from 5' Exons

GKYGGQTLTRKLMLEGRWSAPGRTLTPATSSTRWRVISFEWTEPSLTPGMT,ESTVARLPGSLCWRDDGPLRAGPLRPQQVQPGGEASNGQSHPHPAP,KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHD

Amino Acids from 3' Exons

LRTGLSWGKLRKCEFLEMIDEK,GRGSLGENESASSKSTR,EDGALLGKIEKVRVLRNDRRE