McDonnell Genome Institute

Washington University

CircRNA

chr1|229602194|229602919|-|TAF5L|ENST00000258281.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9809

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

11

Peptide

IHLACDILEEEILIPSIATK

Amino Acids from 5' Exons

ILIPSIATKCLSSILSLSTSISTWSKTVRRAQWKVFTAASMECFCRMLARRMSLSSYRPLKPSRTSYLTSSFEHSITSTWSVSKKTATTTLSATSKVTTILPCAKSSPYIFILTCSLPREQTISCMPVAAPPAVRTTVWSPPTCPALFCRTRLPRSYRRALSESRMGLPPSLPSASMPSITQSSCTLQKSPPIASCLLLGLTTPVNFGVYDPRSNQSPTKTCPASIWLVIFWRR,FFPAPRSDASPLSSLCLPPSQPGPKQSEEHSGKFLQPLPWNVSAECPEGCHAATDHSNHPGHPILQASSIPRQVRGPSPRRQLQLPYPLPPKQQYCPVQSPHLTYSSRAACQENRLSAVCQWQLLPQEQRFGAPRHAQPYSAERGCPRGLTGEHASQGWASLPHYHLLLCLLHRAAVEHCRNLPRQAACCWVQLLYKTLEFTIQEVKIRAPPSRRVPHPFGLYSGGG,SDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEE

Amino Acids from 3' Exons

ILIPSIATKCLSSILSLSTSISTWSKTVRRAQWKVFTAASMECFCRMLARRMSLSSYRPLKPSRTSYLTSSFEHSITSTWSVSKKTATTTLSATSKVTTILPCAKSSPYIFILTCSLPREQTISCMPVAAPPAVRTTVWSPPTCPALFCRTRLPRSYRRALSESRMGLPPSLPSASMPSITQSSCTLQKSPPIASCLLLGLTTPVNFGVYDPRSNQSPTKTCPASIWLVIFWRR,FFPAPRSDASPLSSLCLPPSQPGPKQSEEHSGKFLQPLPWNVSAECPEGCHAATDHSNHPGHPILQASSIPRQVRGPSPRRQLQLPYPLPPKQQYCPVQSPHLTYSSRAACQENRLSAVCQWQLLPQEQRFGAPRHAQPYSAERGCPRGLTGEHASQGWASLPHYHLLLCLLHRAAVEHCRNLPRQAACCWVQLLYKTLEFTIQEVKIRAPPSRRVPHPFGLYSGGG,SDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEE