McDonnell Genome Institute

Washington University

CircRNA

chr1|229540605|229549434|-|ABCB10|ENST00000344517.4

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9358

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

AGFFGALR

Amino Acids from 5' Exons

LAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGA,LRNVLEMELFELLGKKLKSRNMPAKWTMCSQGKRHSPGLVSLE,SGTYWKCKNCSSFWERNDNREICQQSGPCNAVSKERGIRPGWFLWS

Amino Acids from 3' Exons

LRLDFSRCPVLSPCLPLSSWGRSLMSSIPTPLWTTATTPASAGSVPCFCVVLPPMPFVSTSCKLQ,CGWISHDVQCYLHVCPFLPGEDHCHLYQPHCGLQRQPDPPLPRAQCRVSVWCCRQCHSCLPHANF,AVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCGAAANAIRVYLMQTS