McDonnell Genome Institute

Washington University

CircRNA

chr1|229464623|229465519|-|NUP133|ENST00000261396.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9046

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

10

Peptide

KDQISYLLFDMLQAASHYR

Amino Acids from 5' Exons

QQVVLVASERYASMRLSRWLIHRQTATSETSPSSWPSIASWMVMFLSLSLWINPVIGKDMTIWRWNTYRKDQISYLLF,NKWSWWHPNGNNTPADCPEGGLSTGRQQPPKHRDRAAGSPDRLLPGWLCFSAVCGIQSGKIQSGDGIPTEKIRSLISS,TSGPGGIRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYLQKRSDLLSPL

Amino Acids from 3' Exons

DMLQAASHYRQNRNSLYRREESLEKEPEYVPWT,ICCRLLVIIAKIETLCIEEKNHKKNLNMFHGR,YAAGCSLSPKKLFVKRRITRKRTICSMD