McDonnell Genome Institute

Washington University

CircRNA

chr1|229458160|229463676|-|NUP133|ENST00000261396.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9111

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

14

Peptide

IEVSLGQYLWAASLAEK

Amino Acids from 5' Exons

AHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIE,LMQHFWVWQIWKLVTLQRRKPFLAVNWLHLQTFQRICYKKKLK,SCNTSGFGKYGNSLLCKEENPSWLEIGCISFRLFRGYATRKN

Amino Acids from 3' Exons

FHASTCGLLLQRNTVTLIYWYKCVSRLTTRADSSATPSLLI,FTRPVPVGCFSSREILLYIGTNVADQPEPTPALHDPVCS,SLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQ