McDonnell Genome Institute

Washington University

CircRNA

chr1|228304302|228305386|+|OBSCN|ENST00000366707.8

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9979

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

FIDNMTNQEAR

Amino Acids from 5' Exons

PCQPDSTTQTRRPEKGPRPHCTVNARWPLWSGGRDLKPSEMGTDTAGRMGPGVSCRFVACLWQMPGSTRACVGRRGPQPHSRSG,PASQIHRQHDKPGGQRRGHGHTALTEQGGPCGVEEGTNPPRWGQTQPEAGWDQVAADSWPVCGRCRGVLVRVWAGEDLSHTHDQ,LPARFIDNMTNQEAREGATATLHCELSKVAPVEWRKGPETLRDGDRHSLRQDGTRCELQIRGLSVADAGEYSCVCGQERTSATLTIR

Amino Acids from 3' Exons

PCPPSSQRVGMKRPQKGPRLCCSVSARWPLLSGGRDLKPSEMGTDTTGRMGPDVSCRFMACPWQTLGSTHVYVVRRRRRPLSLSR,PARQVHKGSEERGHRRGHGYVAVAEQGGPCVEEGTNPQRWGQIQPEAGWDQMAADSWPVRGRHWGVLMCMWSGEDVGHSHCQ,LPAKFTKGLRNEEATEGATAMLQCELSKVAPVEWRKGPETLRDGDRYNLRQDGTRCELQIHGLSVADTGEYSCVCGQEKTSATLTVK