McDonnell Genome Institute

Washington University

CircRNA

chr1|228298453|228300145|+|OBSCN|ENST00000366707.8

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9865

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

VAPVEWK

Amino Acids from 5' Exons

PCLHDSLKIRPRRPQKGPQLHCSVSARWPLWNGRRVLRPSEMGADTASRMGRGVSCRSMTCLWRMLGNTHACVDKRGPRPRSLSG,PACTIHSRSEDQGGLRRGHSYTAVAEQGGPCGMEEGSDPQRWGQIQPEAGWDEVAADPPVCGGCWGILMHVWTREDLGHAHCQ,LPARFTQDLKTKEASEGATATLQCELSKVAPVEWKKGPETLRDGGRYSLKQDGTRCELQIHDLSVADAGEYSCMCGQERTSATLTVR

Amino Acids from 3' Exons

PCLPDSRIETRRPQKGLQSHCNVSERRPPWSGERGPTPSKMGTGTASRMGPVVSCRFVAWSQMLENTRAYVSRRGPRPRSLSG,PACQIHRGYEKPEGHRRGYSHIAMAEKGGPRGVEKGAQHPQRWGQVQPEAGWDQLAADSWPGHSRCWRILVHMAGEDLGHAHCQ,LPARFIEDMRNQKATEGATVTLQCKLRKAAPVEWRKGPNTLKDGDRYSLKQDGTSCELQIRGLVIADAGEYSCICEQERTSATLTVR