McDonnell Genome Institute

Washington University

CircRNA

chr1|228097077|228097452|+|ARF1|ENST00000470670.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9657

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

27

Peptide

LGWAGPRYKASPCIPHPGFNVETVEYK

Amino Acids from 5' Exons

VSLASVLPPVHKHGEHLRQPLQGPFWQKRNAHPHGGPGCCREDHDPLQAAGDRDHHSHHRGGGQQGVGWAGLGQGTRPHPASRTQASTWKPWSTRTSASLCGTWVARTRSGPCGATTSRTHK,CPWPVSFHLSTSMGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGEVGASREWAGLGWAKVQGLTLHPAPRLQRGNRGVQEHQLHCVGRGWPGQDPAPVAPLLPEHT,VPGQCPSTCPQAWGTSSPTSSRAFLAKKKCASSWWAWMLQGRPRSSTSLSWVRSPPFPPVRWGPAGSGLGWAGPRYKASPCIPHPGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQ

Amino Acids from 3' Exons

VSLASVLPPVHKHGEHLRQPLQGPFWQKRNAHPHGGPGCCREDHDPLQAAGDRDHHSHHRGGGQQGVGWAGLGQGTRPHPASRTQASTWKPWSTRTSASLCGTWVARTRSGPCGATTSRTHK,CPWPVSFHLSTSMGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGEVGASREWAGLGWAKVQGLTLHPAPRLQRGNRGVQEHQLHCVGRGWPGQDPAPVAPLLPEHT,VPGQCPSTCPQAWGTSSPTSSRAFLAKKKCASSWWAWMLQGRPRSSTSLSWVRSPPFPPVRWGPAGSGLGWAGPRYKASPCIPHPGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQ