McDonnell Genome Institute

Washington University

CircRNA

chr1|227016079|227051985|-|CDC42BPA|ENST00000366766.6

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

STSPSTSSEAEPVK

Amino Acids from 5' Exons

GNATRSRNEKINFSNFSHSTHGSWRWNTDPERSAH,EMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPM,KCYEIQKEINFLIQLILITHTWVLEMEYRSKICP

Amino Acids from 3' Exons

TDPVENTYVWNPSVKFHIQSRSTSPSTSSEAEPVK,LIPLRTHMYGTRASSFTSSHGPHLLPHLVKLSQL,SREHICMEPERQVSHPVTVHISFHISAS