McDonnell Genome Institute

Washington University

CircRNA

chr1|227016079|227031514|-|CDC42BPA|ENST00000334218.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9845

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

12

Peptide

DLPMVTASQLSASNNK

Amino Acids from 5' Exons

GNATRSRNEKINFSNFSHSTHGSWRWNTDPERSAH,EMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPM,KCYEIQKEINFLIQLILITHTWVLEMEYRSKICP

Amino Acids from 3' Exons

VTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAII,SQLPSSQHLITNVQSCQTLRMRRISGWECVNCTRFRKTNSETAQSMFPKRLMTALYPSLKQPRQPQS,HSFPALSIQMFNPDASRHEEEVGGSAEIAQDFEEKQIQRPLSLCSQRGLQHSTPHNNPGSRNH