McDonnell Genome Institute

Washington University

CircRNA

chr1|226233095|226277932|-|LIN9|ENST00000328205.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9093

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

STIDASNIR

Amino Acids from 5' Exons

CLAEGGDLNSFEFKSLTDSLNDIKSTIDASNI,VQKEETIPLNSNHLQTHMISRVQTLLIS,SSRRRRPEFLIQITYRLIKYQEYNRRFYQ

Amino Acids from 3' Exons

MFFCIFGREISIKTETAENKALTTKESCRCFTIQRSPRNSFASGYWNESY,CSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGTKVT,VLLHFLRKRDQHNRNGRKGSYNKGKLQMFHNSKISQMKFLCLWLLERKLQ