McDonnell Genome Institute

Washington University

CircRNA

chr1|225519197|225519565|-|ENAH|ENST00000366843.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9375

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

ISSADNYK

Amino Acids from 5' Exons

TTTRTATAKGAGAGKAGARKNGKRKVGEREVRKGKAGEGATGTRTAGERETRTGTAGTPGAAGTPGAAGTPGAAGTPGSGEARKTRTREAGETGTGEARKGATRAVRKGTAGMGERAQNIKC,QLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSA,NYKNSNGKRSWSGKGWSEKEWKEKGWRERGKGKGWRGSDWNKNSWRERDKNGNGRNAWSGRNAWSGRNAWSGRNAWIGRGKKDKNERGWRDWNGRGKKGSDKSSKGNSWNGRESAEYQVL

Amino Acids from 3' Exons

TTTRTATAKGAGAGKAGARKNGKRKVGEREVRKGKAGEGATGTRTAGERETRTGTAGTPGAAGTPGAAGTPGAAGTPGSGEARKTRTREAGETGTGEARKGATRAVRKGTAGMGERAQNIKC,QLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSA,NYKNSNGKRSWSGKGWSEKEWKEKGWRERGKGKGWRGSDWNKNSWRERDKNGNGRNAWSGRNAWSGRNAWSGRNAWIGRGKKDKNERGWRDWNGRGKKGSDKSSKGNSWNGRESAEYQVL