McDonnell Genome Institute

Washington University

CircRNA

chr1|225500991|225519565|-|ENAH|ENST00000366843.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9246

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

31

Peptide

TGTAGTPGAAGTPGAAGTPGAAGTPGSGEAR

Amino Acids from 5' Exons

TKIHTLITAQCQWSPDGRTLQAEA,PKSTPLSQPSANGVQTEGLDYDRLKQ,QNPHPYHSPVPMESRRKDLTMTGS

Amino Acids from 3' Exons

TTTRTATAKGAGAGKAGARKNGKRKVGEREVRKGKAGEGATGTRTAGERETRTGTAGTPGAAGTPGAAGTPGAAGTPGSGEARKTRTREAGETGTGEARKGATRAVRKGTAGMGERAQNIKC,QLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSA,NYKNSNGKRSWSGKGWSEKEWKEKGWRERGKGKGWRGSDWNKNSWRERDKNGNGRNAWSGRNAWSGRNAWSGRNAWIGRGKKDKNERGWRDWNGRGKKGSDKSSKGNSWNGRESAEYQVL