McDonnell Genome Institute

Washington University

CircRNA

chr1|225417983|225424089|-|LBR|ENST00000272163.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9967

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

KCQVGNLPMVK

Amino Acids from 5' Exons

VCFSSCLACLCSSSCCCCVNRKIPVFISLLLCQLCMSYGKPEYLGSTSCGFFKSCSTYCQLE,CVSHHVWPACVPLPVAVDVTERSQSSEFPSSFASFVVMGNQSIWGLPPVVFDSSPVLPTANWK,VFLIMFGLPVFLFLLLLMCKQKDPSLLNFPPPLPALYELWETRVFGVYLLWFLIQVLFYLLPIGK

Amino Acids from 3' Exons

VNYRKCQVGNLPMVKWEVDGLGVHFIMKKFATTAPPSFTLSIKMEQSLNKRMIL,LIIENAKEICRWSGKRSMAWEFTLLSRNSEPRQHLPALHCEVRWNRAIEREY,LKMPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIK