McDonnell Genome Institute

Washington University

CircRNA

chr1|225318582|225337496|+|DNAH14|ENST00000327794.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9973

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

TGGSVLLQK

Amino Acids from 5' Exons

KTANELKSVLPAFDKAIVALNALDKADVAEL,KLPMNKVCCQPLTRQLWLMPWIKLMSLN,NCQTKKCAASLQGNCGSECPGSCRIK

Amino Acids from 3' Exons

ISRWHNQGLPHGQYSVENAILIKNGQQWPLLIDPHRQAHKWIRQMEGSRLQKLSIEDSNYTKKIENAMKTGGSVLLQ,SADGIIRDCLMVSIQRMPSSRMASSGHCLTHIGKLTNGSVRWKDPGCRSSPLKTAIIPKKLKMLRQEGVSSC,QPMASGTASWSVFSRECHLDQEWPAVATADPTASSQMDPSDGRIQAAEALHRQQLYQKNKCYEDRRECPPA