McDonnell Genome Institute

Washington University

CircRNA

chr1|225080378|225290082|+|DNAH14|ENST00000430092.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9645

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

15

Peptide

GKPTVLMVPNLNIEQIR

Amino Acids from 5' Exons

IRTPLLLCAGTQVSTAMEMIQTLSGEAASLTNKAKAYSHYQDCFSDSQSHMHSVNVEEITQIVLSEISDIEGDLTLRKKLWEAQEEWKRASWEWRNSSLQSIDVESVQRNVSKLMHIISVLEK,ELLFCYVLVLKCQQQWKSRLSQGKLQVLTKLKHIHIIRIVSVILNLICILLMWKKLHRLCFQRSLTLKVTLGKNYGKHKRSGSEPLGNGGIVLFKVLMNQYREMFQNCTSRYKK,KNSSSVMCWYSSVNSNGNDPDSLRGSCKFNQSSIFTLSGLFQFSISYAFCCGRNYTDCAFRDLHRLDFEEKTMGSTRGVEASLLGMEEFSSKYCRISTEKCFKTDAHNLGTRK

Amino Acids from 3' Exons

IGIDGCGKKTCATLACYLTDNKLYRVPISHKCAYIEFKEVFKKVFIHAGLKGKPTVLMVPNLNIEQ,LEMDVGKKHVQPWPVIQIINYTECLYLTNVPTSNSKKSLKRCLFTQDKGNPLFWFPITN,WNRWMWEKNMCNLGLLFDRTIPSAYISQMCLHRIQRSLKGVYSRRIKRETHCSDGSQFKHRT