McDonnell Genome Institute

Washington University

CircRNA

chr1|22506048|22509233|+|ZBTB40|ENST00000374651.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9474

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

EVILNCCEGRTPK

Amino Acids from 5' Exons

VILNCCEGRTPKETIENLLHRMTEEKTLTAEGLVKLLQAVKTTFPNLGLLLEKLQKSATLPSTT,FIAVRAEHPRRQKICCTELKRRRLLRVWNSSRLRRLSQTWAFCRSCRNQPLCQAPQ,DSELLGQNTQGDNRKFVAQNDREDADCGFGKTPPGCEDDFPKPGPSAREVAEISHFAKHH

Amino Acids from 3' Exons

PPQNMPLKQSGITSSWRPSNRRLSTSSLPRRRSTWQRLK,DHPRTCHFRNNPEAPVDLGGHPTEDVQALYLGGGAPGRDCER,TTPEHATLETILRHNQLILEAIQQKIEYKLFTSEEEHLAETVKE