McDonnell Genome Institute

Washington University

CircRNA

chr1|225038693|225168028|+|DNAH14|ENST00000430092.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9929

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

RLYSFIINFR

Amino Acids from 5' Exons

NIQGQLFSYWKDNKLRTCFKVTCYFCSKVRSKNRHY,TFKDNSFPTGKTTNDCEELVDNSKLHAISVQKSEVKTDTDINE,HSRTTLFLLERQQMIVKNLLIIQSYMLFLFKSQKKQTLILM

Amino Acids from 3' Exons

KVIYTATQQLGLQNWSSQKEKIIQFYNQLQ,KYILQLSNWVYKTGHLRKRRLYSFIINF,SNIYCNSAIGFTKLVISEREDYTVLSTS