McDonnell Genome Institute

Washington University

CircRNA

chr1|225007412|225100884|+|DNAH14|ENST00000430092.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9563

51

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

SLELDSSR

Amino Acids from 5' Exons

LDSSRTYSLDEFCEEQLQQATQALKQLEDIRNKAISEMKSTFLK,WIVLEHILMNFVKSSYSKLPRHNNLRTSGIKQFQRKVLF,GFSNIFSRILRAVTASYPGIETTGHQESNFRDEKYFSK

Amino Acids from 3' Exons

ATPSRNRTFLSSDFHVEKNNVKNTKQTECFADNHFCRSPNSAKLYTSTYKEKP,QLPAETELFSQVISMWKKIMSKIQNKQNALQITTSAGVLEILQNCNIHLEHIKKSLE,NSQQKQNFSLKFPCGKKCQKYKTNRMLCRPLLQESLKFCKIVIYILNIRKAL