McDonnell Genome Institute

Washington University

CircRNA

chr1|224398888|224418416|-|WDR26|ENST00000414423.6

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9381

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

11

Peptide

TLQIGTSYLPPSVMLPPR

Amino Acids from 5' Exons

DLDGNLLDSWEGVRVQCLWCLSDGKTVLASDTHQRIRGYNFEDLTDRN,TMVISLTPGKGECNAFGAVMERLFWHQIHTSEFGAITSRTLQIGT,LRWSPLLGRGKSAMPLVLEWKDCSGIRYTPANSGLLRGPYREH

Amino Acids from 3' Exons

PIYHHQCFPHGVYRLSCGRRWNYKGIGAYITIPNLIIIILCLCLTMFVV,LFTTISDASPTAFTDSPAAGGGTTKGSVPISQYQTSRFCVSAYRPCL,YLPPSVMLPPRRLQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCS