McDonnell Genome Institute

Washington University

CircRNA

chr1|223789007|223793440|-|TP53BP2|ENST00000343537.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9589

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

ATLSAPNFFMGK

Amino Acids from 5' Exons

DSITLCCLMQRPSVVFGGVRSRCVCHDLQHADCCRVRGNGGRLHSVLPISL,TPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLY,LHYIVLPHVTTSKCVSFWWSQEPLCLPPTVTCRLLQISARKWRKATLSAPNFFM

Amino Acids from 3' Exons

GKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYE,VKGQTCVKLAQSVSLMEGNSTPLLYCIRLWRENLTLYRELFM,KDKLANWLRAYRSWNEGEIQPPCFTARFVFGGRIPCTENYL