McDonnell Genome Institute

Washington University

CircRNA

chr1|223746996|223762251|+|CAPN2|ENST00000295006.5

Cancer

Type of Peptide

CRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9221

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

15

Peptide

TLMMDSGDCLPSWQER

Amino Acids from 5' Exons

DQRMLSAIRGCHHGLRRLHRRHCVVVEEAPSQPVQDHPESSAKRLSPWLLHR,INGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSID,STDAMKRYQGVPPLRASKTSPEALLSGMSRSPLPTCSRSSRKLCKKALSLAAPS

Amino Acids from 3' Exons

FDISEDDIDDGFRRLFAQLAGE,STSARMTLMMDSGDCLPSWQE,RHQRGHWIQETVCPVGRR