McDonnell Genome Institute

Washington University

CircRNA

chr1|223615969|223620266|-|CAPN8|ENST00000366872.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.911

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

VESHRPPAEGR

Amino Acids from 5' Exons

PRTGPIPSSKSVWMKWMRTRRRASVNPAVQCCWACRKIAGGGSGDKACLASAMPST,HVLDQSPVQNPFGSGGPGGEHRTLLYSAAGPDAEKSQVAEADRTRHAHRLCRLP,TYWTNPQFKIRLDEVDEDQEESIGEPCCTVLLGLMQKNRRWRKRIGQGMLSIGYAVYQ

Amino Acids from 3' Exons

CTRVESHRPPAEGRTGQESGWRIL,APEWNHIDPRRKEELDKKVEDGEF,HQSGITTPGGRKNWTRKLRMENS