McDonnell Genome Institute

Washington University

CircRNA

chr1|222724091|222730177|+|BROX|ENST00000340934.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9935

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

ENGFIITEDEAKEVHR

Amino Acids from 5' Exons

YNRRSKRSSSKPKDCSWDFTFK,ITEDEAKEVHRSLKIAAGIFKHLK,QKMKQKKFIEARLQLGFLNI

Amino Acids from 3' Exons

CMQRQKHCVKNMEKPKDLDQQSNLQDICSLGNLETLRTPKNVREKMDL,VCKGRSTVRIWRNQRTWTNSQTFRTSVLETWKPCEEHPRKMSERKWIY,YAKAEALCKEYGETKGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGF