McDonnell Genome Institute

Washington University

CircRNA

chr1|222654654|222660314|+|MIA3|ENST00000340535.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9159

49

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

SEFDQVK

Amino Acids from 5' Exons

TRRNWKMTATHYKLPKLDWKMNAKPGRKWRFMSSISRRRWLCK,PGKEIGRPQLTTSCQSWTGRMQNLEAESGDSEALSAEGDGFAK,QVKKLEDDRNSLQAAKAGLEDECKTLRQKVEILNELYQQKEMALQ

Amino Acids from 3' Exons

VLARMALLAHPLVVENAPLHQWSHPDLSLLLSIEEICLEVNL,SSEPEWLFWPIPCEWWRMLPSIDSGATRETSLCYSQSKRYAKI,PLSQNGSFGPSPVSGGECSPPLTVEPPVRPLSATLNRRDMPRSEF