McDonnell Genome Institute

Washington University

CircRNA

chr1|220182717|220232863|-|RAB3GAP2|ENST00000358951.6

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.972

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

ISEEEYVALGK

Amino Acids from 5' Exons

DLALLLRLDEKELLKLQALLEKYKQENTRTNVRFSDDKDGVLPVKTFLEYLEYEKDVLNIKKISEEEYVAL,TWLCYGLMKKNCLSSRHYRNISKRTPGQMFDFLMIKMVCCLKHSWNINMKRMCSTRKVKRNMWL,LGSVTKAKRTAAPGITREIAREHQDKCSIFRWCVACKNILGIFRIKGCAQHKENKRGICGF

Amino Acids from 3' Exons

VNQQTGKMMVGEHGKKMNHKN,INRLGRWLGSMGRKTTRT,KSTDWEDDGWGAWEENEPQEP