McDonnell Genome Institute

Washington University

CircRNA

chr1|220182717|220189767|-|RAB3GAP2|ENST00000358951.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9777

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

7

Peptide

ISEEEYVALDLVETEIK

Amino Acids from 5' Exons

DLALLLRLDEKELLKLQALLEKYKQENTRTNVRFSDDKDGVLPVKTFLEYLEYEKDVLNIKKISEEEYVAL,TWLCYGLMKKNCLSSRHYRNISKRTPGQMFDFLMIKMVCCLKHSWNINMKRMCSTRKVKRNMWL,LGSVTKAKRTAAPGITREIAREHQDKCSIFRWCVACKNILGIFRIKGCAQHKENKRGICGF

Amino Acids from 3' Exons

IWLKQKRNFLILNTLQPKN,FGNRNKGINSYIPCNQKT,LVETEIKELILDIKYPATKKQ